Recombinant Human INMT Protein, GST-tagged

• Cat.No.: INMT-5114H
• Product Overview: Human INMT partial ORF ( NP_006765, 174 a.a. - 263 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine. [provided by RefSeq
• Molecular Mass: 35.64 kDa
• AA Sequence: DAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKGEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCCIVARKKPGP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: INMT indolethylamine N-methyltransferase [ Homo sapiens ]
• Official Symbol: INMT
• Synonyms: INMT; indolethylamine N-methyltransferase; amine N-methyltransferase; nicotine N-methyltransferase; arylamine N-methyltransferase; indolamine N-methyltransferase; aromatic alkylamine N-methyltransferase; MGC125940; MGC125941
• Gene ID: 11185
• mRNA Refseq: NM_001199219
• Protein Refseq: NP_001186148
• MIM: 604854
• UniProt ID: O95050