Recombinant Human INMT Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: INMT-6553H
• Product Overview: INMT MS Standard C13 and N15-labeled recombinant protein (NP_006765) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream MINDY4 (aka FAM188B) gene. In rodents and other mammals such as cetartiodactyla this gene is in the opposite orientation compared to its orientation in human and other primates and this gene appears to have been lost in carnivora and chiroptera.
• Molecular Mass: 28.7 kDa
• AA Sequence: MKGGFTGGDEYQKHFLPRDYLATYYSFNGSPSPEAEMLKFNLECLHKTFGPGGLQGDTLIDIGSGPTIYQVLAACDSFQDITLSDFTDRNREELEKWLKKEPGAYDWTPAVKFACELEGNSGRWEEKEEKLRAAVKRVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLLKPGGHLVTTVTLRLPSYVVGKREFSCVALEKEEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCCIVARKKPGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: INMT indolethylamine N-methyltransferase [ Homo sapiens (human) ]
• Official Symbol: INMT
• Synonyms: INMT; indolethylamine N-methyltransferase; amine N-methyltransferase; nicotine N-methyltransferase; arylamine N-methyltransferase; indolamine N-methyltransferase; aromatic alkylamine N-methyltransferase; MGC125940; MGC125941
• Gene ID: 11185
• mRNA Refseq: NM_006774
• Protein Refseq: NP_006765
• MIM: 604854
• UniProt ID: O95050