Recombinant Human INIP Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: INIP-1764H
• Product Overview: C9orf80 MS Standard C13 and N15-labeled recombinant protein (NP_067041) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: The protein encoded by this gene is a subunit of single-stranded DNA binding complexes that are important for maintaining genome stability. These complexes are involved in G2/M checkpoint control and homologous recombination repair.
• Molecular Mass: 11.4 kDa
• AA Sequence: MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: INIP INTS3 and NABP interacting protein [ Homo sapiens (human) ]
• Official Symbol: INIP
• Synonyms: MISE; SOSSC; SSBIP1; C9orf80; HSPC043; hSSBIP1; RP11-276E15.2
• Gene ID: 58493
• mRNA Refseq: NM_021218
• Protein Refseq: NP_067041
• MIM: 613273
• UniProt ID: Q9NRY2