Recombinant Human INIP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : INIP-1764H
Product Overview : C9orf80 MS Standard C13 and N15-labeled recombinant protein (NP_067041) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a subunit of single-stranded DNA binding complexes that are important for maintaining genome stability. These complexes are involved in G2/M checkpoint control and homologous recombination repair.
Molecular Mass : 11.4 kDa
AA Sequence : MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name INIP INTS3 and NABP interacting protein [ Homo sapiens (human) ]
Official Symbol INIP
Synonyms MISE; SOSSC; SSBIP1; C9orf80; HSPC043; hSSBIP1; RP11-276E15.2
Gene ID 58493
mRNA Refseq NM_021218
Protein Refseq NP_067041
MIM 613273
UniProt ID Q9NRY2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All INIP Products

Required fields are marked with *

My Review for All INIP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon