Recombinant Human INIP Protein, GST-Tagged

• Cat.No.: INIP-0214H
• Product Overview: Human C9orf80 full-length ORF (NP_067041.1, 1 a.a. - 104 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a subunit of single-stranded DNA binding complexes that are important for maintaining genome stability. These complexes are involved in G2/M checkpoint control and homologous recombination repair. [provided by RefSeq, Jul 2016]
• Molecular Mass: 37.8 kDa
• AA Sequence: MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: INIP INTS3 and NABP interacting protein [ Homo sapiens ]
• Official Symbol: INIP
• Synonyms: MISE; SOSSC; SSBIP1; C9orf80; HSPC043; hSSBIP1; RP11-276E15.2
• Gene ID: 58493
• mRNA Refseq: NM_021218
• Protein Refseq: NP_067041
• MIM: 613273
• UniProt ID: Q9NRY2