Recombinant Human INHBB Protein

• Cat.No.: INHBB-01H
• Product Overview: Recombinant Human INHBB Protein was expressed in CHO cell

Specification

• Species: Human
• Source: CHO
• Description: This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate a subunit of the dimeric activin and inhibin protein complexes. These complexes activate and inhibit, respectively, follicle stimulating hormone secretion from the pituitary gland. Polymorphisms near this gene are associated with pre-eclampsia in female human patients.
• Form: Lyophilized
• Molecular Mass: 13 kDa
• AA Sequence: GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
• Endotoxin: <= 1 EUs/ug (LAL gel clot method)
• Purity: > 95%
• Applications: Western Blot
• Storage: Stored at -20°C to-80°C.
• Storage Buffer: Lyophilized from PBS, pH 7.2.
• Instructions: After reconstitution with sterile water not less than 0.1 mg/mL, store at -20°C to -80°C for 6 months, store at 4°C for 1 month. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: INHBB inhibin subunit beta B [ Homo sapiens (human) ]
• Official Symbol: INHBB
• Synonyms: Inhibin, beta-2,activin AB beta polypeptide,inhibin beta B subunit
• Gene ID: 3625
• mRNA Refseq: NM_002193.4
• Protein Refseq: NP_002184.2
• MIM: 147390
• UniProt ID: P09529