Active Recombinant Human INHBB Protein

• Cat.No.: INHBB-5119H
• Product Overview: Human INHBB (P09529) partial recombinant protein expressed in Hi-5 (BTI-Tn-5B1-4) cells.

Specification

• Species: Human
• Source: Insect Cells
• Tag: Non
• Description: The inhibin beta B subunit joins the alpha subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. Because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Furthermore, the beta B subunit forms a homodimer, activin B, and also joins with the beta A subunit to form a heterodimer, activin AB, both of which stimulate FSH secretion. [provided by RefSeq
• Form: Lyophilized
• Bio-activity: The ED50 as determined by its ability to inhibit the proliferation of murine MPC-11 cells is <= 2.0 ng/mL, corresponding to a specific activity of >= 5 x 105 units/mg.
• Molecular Mass: 25.6 kDa
• AA Sequence: GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
• Endotoxin: Endotoxin level is < 0.1 ng/μg of protein (< 1 EU/μg).
• Purity: 95%
• Applications: Functional Study
  SDS-PAGE
• Usage: Activity assay
  SDS-PAGE
  The optimal working dilution should be determined by the end user.
• Storage: Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: Lyophilized from solutions contain no sodiun azide nor carrier protein

Gene Information

• Gene Name: INHBB inhibin, beta B [ Homo sapiens ]
• Official Symbol: INHBB
• Synonyms: INHBB; inhibin, beta B; inhibin, beta B (activin AB beta polypeptide); inhibin beta B chain; Inhibin, beta-2; activin beta-B chain; activin AB beta polypeptide; MGC157939
• Gene ID: 3625
• mRNA Refseq: NM_002193
• Protein Refseq: NP_002184
• MIM: 147390
• UniProt ID: P09529