Recombinant Human ING5, His-tagged

Cat.No. : ING5-27620TH
Product Overview : Recombinant fragment, corresponding to amino acids 2-240 of Human ING5 with N terminal His tag; 239 amino acids, kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2-240 a.a.
Description : The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in TP53-dependent regulatory pathway.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 71 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAE IDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYS DDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKMEGSDFESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKK HKGGSEFTDTILSVHPSDVLDMPVDPNEPTYCLCHQVS YGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK
Gene Name ING5 inhibitor of growth family, member 5 [ Homo sapiens ]
Official Symbol ING5
Synonyms ING5; inhibitor of growth family, member 5; inhibitor of growth protein 5; FLJ23842; p28ING5;
Gene ID 84289
mRNA Refseq NM_032329
Protein Refseq NP_115705
MIM 608525
Uniprot ID Q8WYH8
Chromosome Location 2q37.3
Function metal ion binding; methylated histone residue binding; protein binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ING5 Products

Required fields are marked with *

My Review for All ING5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon