Recombinant Human ING5, His-tagged

• Cat.No.: ING5-27620TH
• Product Overview: Recombinant fragment, corresponding to amino acids 2-240 of Human ING5 with N terminal His tag; 239 amino acids, kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 2-240 a.a.
• Description: The protein encoded by this gene is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This protein can bind TP53 and EP300/p300, a component of the histone acetyl transferase complex, suggesting its involvement in TP53-dependent regulatory pathway.
• Conjugation: HIS
• Form: Lyophilised:Reconstitute with 71 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: ATAMYLEHYLDSIENLPCELQRNFQLMRELDQRTEDKKAE IDILAAEYISTVKTLSPDQRVERLQKIQNAYSKCKEYS DDKVQLAMQTYEMVDKHIRRLDADLARFEADLKDKMEGSDFESSGGRGLKKGRGQKEKRGSRGRGRRTSEEDTPKKKK HKGGSEFTDTILSVHPSDVLDMPVDPNEPTYCLCHQVS YGEMIGCDNPDCPIEWFHFACVDLTTKPKGKWFCPRCVQEKRKKK

Gene Information

• Gene Name: ING5 inhibitor of growth family, member 5 [ Homo sapiens ]
• Official Symbol: ING5
• Synonyms: ING5; inhibitor of growth family, member 5; inhibitor of growth protein 5; FLJ23842; p28ING5
• Gene ID: 84289
• mRNA Refseq: NM_032329
• Protein Refseq: NP_115705
• MIM: 608525
• Uniprot ID: Q8WYH8
• Chromosome Location: 2q37.3
• Function: metal ion binding; methylated histone residue binding; protein binding; zinc ion binding