Recombinant Human ING1 Protein, His tagged

• Cat.No.: ING1-001H
• Product Overview: Recombinant Human ING1 Protein (213-327 aa) with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Non
• Protein Length: 213-327 aa
• Description: This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
• Molecular Mass: 14 kDa
• Purity: > 90% by SDS-PAGE
• AA Sequence: MLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSHHHHHHHH
• Endotoxin: < 1.0 EU/μg by LAL
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH8.2, 8% Trehalose, 10% Glycerol
• Concentration: 1 mg/mL by BCA

Gene Information

• Gene Name: ING1 inhibitor of growth family member 1 [ Homo sapiens (human) ]
• Official Symbol: ING1
• Synonyms: ING1; inhibitor of growth family, member 1; inhibitor of growth protein 1; growth inhibitor ING1; growth inhibitory protein ING1; inhibitor of growth 1; p24ING1c; p33; p33ING1; p33ING1b; p47; p47ING1a; tumor suppressor ING1
• Gene ID: 3621
• mRNA Refseq: NM_005537
• Protein Refseq: NP_005528
• MIM: 601566
• UniProt ID: Q9UK53