Recombinant Human IMPA2 Protein, GST-tagged

• Cat.No.: IMPA2-5143H
• Product Overview: Human IMPA2 full-length ORF ( NP_055029.1, 1 a.a. - 288 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This locus encodes an inositol monophosphatase. The encoded protein catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling. This locus may be associated with susceptibility to bipolar disorder. [provided by RefSeq, Jan 2011]
• Molecular Mass: 57.7 kDa
• AA Sequence: MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IMPA2 inositol(myo)-1(or 4)-monophosphatase 2 [ Homo sapiens ]
• Official Symbol: IMPA2
• Synonyms: IMPA2; inositol(myo)-1(or 4)-monophosphatase 2; inositol monophosphatase 2; IMP 2; IMPase 2; inosine monophosphatase 2; myo-inositol monophosphatase A2; inositol monophosphatase 2 variant 1; inositol monophosphatase 2 variant 2
• Gene ID: 3613
• mRNA Refseq: NM_014214
• Protein Refseq: NP_055029
• MIM: 605922
• UniProt ID: O14732