Recombinant Human immunodeficiency virus 1 rev protein, His-tagged

• Cat.No.: rev-5757H
• Product Overview: Recombinant Human immunodeficiency virus 1 rev protein(V9MMW3)(1-107aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human immunodeficiency virus 1
• Source: E.coli
• Tag: His
• ProteinLength: 1-107aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.1 kDa
• AASequence: MAGGNEDRDEELLRAVRIIKILYQSNPYPEPRGTRQARKNRRRRWRARQRQIHSISERILSACLGRPAEPVPLQLPPIERLHISGSESVGTSGTQQSQGTTEGVGSP
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.