Recombinant Human immunodeficiency virus 1 Nef protein, T7/His-tagged

• Cat.No.: nef-225H
• Product Overview: Recombinant HIV-1 Nef gene cDNA (206 aa, derived from NL4-3 strain) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human immunodeficiency virus 1
• Source: E.coli
• Tag: His&T7
• ProteinLength: 206 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Sucrose.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGFGGKWSKSSVIGWPAVRERMRRAEPAADGVGAVSRDLEKHGAITSSNT AANNAACAWLEAQEEEEVGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGYFPD WQNYTPGPGVRYPLTFGWCYKLVPVEPDKVEEANKGENTSLLHPVSLHGMDDPEREVLEWRFDSRLAFHHVAREL HPEYFKNC
• Purity: >90% by SDS-PAGE
• Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Information

• Gene Name: nef p27 [ Human immunodeficiency virus 1 ]
• Official Symbol: nef
• Synonyms: p27; Nef
• Gene ID: 156110
• Protein Refseq: NP_057857
• UniProt ID: P04601
• Pathway: Assembly Of The HIV Virion, organism-specific biosystem; Early Phase of HIV Life Cycle, organism-specific biosystem; Host Interactions of HIV factors, organism-specific biosystem