Recombinant Human IMMP2L Protein, GST-tagged

• Cat.No.: IMMP2L-5152H
• Product Overview: Human IMMP2L partial ORF ( NP_115938, 31 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrial intermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins. IMP1 (IMMP1L; MIM 612323) and IMP2 are the catalytic subunits of the IMP complex (Burri et al., 2005 [PubMed 15814844]).[supplied by OMIM
• Molecular Mass: 33.66 kDa
• AA Sequence: DRVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALEGDIVR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IMMP2L IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: IMMP2L
• Synonyms: IMMP2L; IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae); IMP2 inner mitochondrial membrane protease like (S. cerevisiae); mitochondrial inner membrane protease subunit 2; IMP2; inner mitochondrial membrane peptidase 2 like; IMP2-LIKE
• Gene ID: 83943
• mRNA Refseq: NM_001244606
• Protein Refseq: NP_001231535
• MIM: 605977
• UniProt ID: Q96T52