Recombinant Human ILK protein, His-tagged

Cat.No. : ILK-7343H
Product Overview : Recombinant Human ILK protein(Q13418)(1-452aa), fused with N-terminal His tag, was expressed in Insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect cells
Tag : His
Protein Length : 1-452aa
Tag : N-His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 54.8 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
Gene Name ILK integrin-linked kinase [ Homo sapiens ]
Official Symbol ILK
Synonyms ILK; integrin-linked kinase; integrin-linked protein kinase; ILK-1; p59ILK; integrin-linked kinase-2; 59 kDa serine/threonine-protein kinase; P59; ILK-2; DKFZp686F1765;
Gene ID 3611
mRNA Refseq NM_001014794
Protein Refseq NP_001014794
MIM 602366
UniProt ID Q13418

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ILK Products

Required fields are marked with *

My Review for All ILK Products

Required fields are marked with *

0

Inquiry Basket

cartIcon