Recombinant Human IL9 protein, His-SUMO-tagged
Cat.No. : | IL9-3566H |
Product Overview : | Recombinant Human IL9 protein(P15248)(19-144aa), fused with N-terminal His and SUMO tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 19-144aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 27.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI |
Gene Name | IL9 interleukin 9 [ Homo sapiens ] |
Official Symbol | IL9 |
Synonyms | IL9; interleukin 9; interleukin-9; homolog of mouse T cell and mast cell growth factor 40; HP40; IL 9; P40; p40 cytokine; p40 T cell and mast cell growth factor; T cell growth factor p40; cytokine P40; T-cell growth factor p40; p40 T-cell and mast cell growth factor; IL-9; |
Gene ID | 3578 |
mRNA Refseq | NM_000590 |
Protein Refseq | NP_000581 |
MIM | 146931 |
UniProt ID | P15248 |
◆ Recombinant Proteins | ||
IL9-8866H | Active Recombinant Human IL9,His-tagged | +Inquiry |
IL9-192H | Active Recombinant Human IL9 Protein | +Inquiry |
IL9-173H | Active Recombinant Human IL9 Protein (Gln19-Ile144), N-His tagged, Animal-free, Carrier-free | +Inquiry |
IL9-3294C | Recombinant Chicken IL9 | +Inquiry |
IL9-230I | Active Recombinant Human IL9 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL9-618HCL | Recombinant Human IL9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL9 Products
Required fields are marked with *
My Review for All IL9 Products
Required fields are marked with *
0
Inquiry Basket