Active Recombinant Human IL9 Protein

Cat.No. : IL9-192H
Product Overview : Recombinant Human IL9 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Interleukin 9 (IL-9) is a cytokine produced by type 2 T helper (Th2) cells and regulates hematopoietic cells. IL-9 signals through the interleukin 9 receptor (IL9R) to activate STAT signaling. IL-9 functions to induce cell proliferation, prevent cell apoptosis, and is associated with asthma and airway hyperresponsiveness.
Bio-activity : MO7e cell proliferation, ≤2 ng/mL
Molecular Mass : Monomer, 14.3 kDa (127 aa)
AA Sequence : MQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name IL9 interleukin 9 [ Homo sapiens (human) ]
Official Symbol IL9
Synonyms IL9; interleukin 9; interleukin-9; homolog of mouse T cell and mast cell growth factor 40; HP40; IL 9; P40; p40 cytokine; p40 T cell and mast cell growth factor; T cell growth factor p40; cytokine P40; T-cell growth factor p40; p40 T-cell and mast cell growth factor; IL-9;
Gene ID 3578
mRNA Refseq NM_000590
Protein Refseq NP_000581
MIM 146931
UniProt ID P15248

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL9 Products

Required fields are marked with *

My Review for All IL9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon