Active Recombinant Human IL9 Protein

• Cat.No.: IL9-230I
• Product Overview: Recombinant Human IL9 Protein without tag was expressed in CHO.

Specification

• Species: Human
• Source: CHO
• Description: Interleukin 9, also known as IL9, is a cytokine (cell signalling molecule) belonging to the group of interleukins. The protein encoded by this gene is a cytokine produced by T-cells and specifically by CD4+ helper cells that acts as a regulator of a variety of hematopoietic cells. This cytokine stimulates cell proliferation and prevents apoptosis. It functions through the interleukin-9 receptor (IL9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. The gene encoding this cytokine has been identified as a candidate gene for asthma. Genetic studies on a mouse model of asthma demonstrated that this cytokine is a determining factor in the pathogenesis of bronchial hyperresponsiveness.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 1 ng/mL, measured in a cell proliferation assay using MO7e cells, corresponding to a specific activity of > 1 × 10^6 units/mg.
• Molecular Mass: 25-40 kDa, observed by non-reducing SDS-PAGE.
• AA Sequence: QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant human Interlerkin 9 (IL-9) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIL-9 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: IL9 interleukin 9 [ Homo sapiens ]
• Official Symbol: IL9
• Synonyms: IL9; interleukin 9; interleukin-9; homolog of mouse T cell and mast cell growth factor 40; HP40; IL 9; P40; p40 cytokine; p40 T cell and mast cell growth factor; T cell growth factor p40; cytokine P40; T-cell growth factor p40; p40 T-cell and mast cell growth factor; IL-9
• Gene ID: 3578
• mRNA Refseq: NM_000590
• Protein Refseq: NP_000581
• MIM: 146931
• UniProt ID: P15248