Recombinant Human IL5 protein, His-tagged

• Cat.No.: IL5-126H
• Product Overview: Recombinant Human IL5(Ile20-Ser134) fused with His tag at C-terminal was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: Ile20-Ser134
• Description: IL-5 is expressed in eosinophils, NK cells, TC2 CD8+ T cells, mast cells, CD45+ CD4+ T cells, gamma delta T cells and IL-1 beta activated endothelial cells. IL-5 acts as a growth and differentiation factor for both B cells and eosinophils. Relative to B cells, IL-5 appears to induce the differentiation of activated conventional B-2 cells into Ig-secreting cells. In addition, it induces the growth of B-1 progenitors as well as IgM production by B-1 cells.IL-5 appears to perform a number of functions on eosinophils. These include the down modulation of Mac-1,the upregulation of receptors for IgA and IgG,the stimulation of lipid mediator (leukotriene C4 and PAF) secretion and the induction of granule release.IL-5 also promotes the growth and differentiation of eosinophils.
• Form: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
• AA Sequence: IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTV ERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIESVDHHHHHH
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration less than 100 μg/ml.
  Dissolve the lyophilized protein in ddH2O.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Shipping: The product is shipped at ambient temperature.

Gene Information

• Gene Name: IL5 interleukin 5 (colony-stimulating factor, eosinophil) [ Homo sapiens ]
• Official Symbol: IL5
• Synonyms: IL5; interleukin 5 (colony-stimulating factor, eosinophil); interleukin-5; B cell differentiation factor I; EDF; eosinophil differentiation factor; IL 5; interleukin 5; T cell replacing factor; TRF; T-cell replacing factor; B-cell differentiation factor I; IL-5
• Gene ID: 3567
• mRNA Refseq: NM_000879
• Protein Refseq: NP_000870
• MIM: 147850
• UniProt ID: P05113
• Chromosome Location: 5q23-q31
• Pathway: Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Asthma, organism-specific biosystem; Asthma, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem
• Function: cytokine activity; growth factor activity; interleukin-5 receptor binding; protein binding