Recombinant Human IL4R Protein, GST-tagged

• Cat.No.: IL4R-5179H
• Product Overview: Human IL4R partial ORF ( NP_000409, 26 a.a. - 135 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes the alpha chain of the interleukin-4 receptor, a type I transmembrane protein that can bind interleukin 4 and interleukin 13 to regulate IgE production. The encoded protein also can bind interleukin 4 to promote differentiation of Th2 cells. A soluble form of the encoded protein can be produced by an alternate splice variant or by proteolysis of the membrane-bound protein, and this soluble form can inhibit IL4-mediated cell proliferation and IL5 upregulation by T-cells. Allelic variations in this gene have been associated with atopy, a condition that can manifest itself as allergic rhinitis, sinusitus, asthma, or eczema. Two transcript variants encoding different isoforms, a membrane-bound and a soluble form, have been found for this gene. [provided by RefSeq
• Molecular Mass: 37.84 kDa
• AA Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IL4R interleukin 4 receptor [ Homo sapiens ]
• Official Symbol: IL4R
• Synonyms: IL4R; interleukin 4 receptor; interleukin-4 receptor subunit alpha; CD124; IL-4 receptor subunit alpha; interleukin-4 receptor alpha chain; IL4RA; IL-4RA
• Gene ID: 3566
• mRNA Refseq: NM_000418
• Protein Refseq: NP_000409
• MIM: 147781
• UniProt ID: P24394