Recombinant Human IL3RA protein, T7/His-tagged

• Cat.No.: IL3RA-109H
• Product Overview: Recombinant human CD123 cDNA (19-305 aa, derived from BC035407) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 19-305 a.a.
• Form: 0.2 mg/ml in sterile-filtered solution in 20 mM Tris, pH 7.5. Proprietary formulation of NaCl , KCl, EDTA, arginine, DTT, and glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVN NSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLY LNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMT AKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQ RFECDQEEGANTRAWR
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro CD123 mediated IL3 signaling regulation study with this protein as either coating matrix protein or soluble factor.2. May be used for CD123 protein-protein interaction assay.3. Potential diagnostic biomarker for acute myeloid leukemia and lupus dieases.4. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: IL3RA interleukin 3 receptor, alpha (low affinity) [ Homo sapiens ]
• Official Symbol: IL3RA
• Synonyms: IL3RA; interleukin 3 receptor, alpha (low affinity); interleukin-3 receptor subunit alpha; CD123; IL-3RA; IL-3R-alpha; CD123 antigen; IL-3R subunit alpha; IL-3 receptor subunit alpha; IL-3 receptor alpha SP2 isoform; IL3R; IL3RX; IL3RY; IL3RAY; hIL-3Ra; M
• Gene ID: 3563
• mRNA Refseq: NM_002183
• Protein Refseq: NP_002174
• MIM: 308385
• UniProt ID: P26951
• Chromosome Location: Xp22.3 and Yp13.3
• Pathway: Apoptosis, organism-specific biosystem; Apoptosis, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem
• Function: interleukin-3 receptor activity; receptor activity