Recombinant Human IL3RA Protein, His/Flag/StrepII-tagged

• Cat.No.: IL3RA-5184H
• Product Overview: Purified IL3RA (NP_002174.1, 19 a.a. - 305 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.

Specification

• Species: Human
• Source: Human Cells
• Tag: Flag&His&Strep II
• Protein Length: 19-305 a.a.
• Description: The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y. [provided by RefSeq
• Form: Liquid
• Bio-activity: Not Tested
• Molecular Mass: 34.65 kDa
• AA Sequence: TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR
• Applications: Western Blot
  Enzyme-linked Immunoabsorbent Assay
  SDS-PAGE
  Protein Interaction
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Concentration: ≥ 10 μg/mL
• Storage Buffer: 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.

Gene Information

• Gene Name: IL3RA interleukin 3 receptor, alpha (low affinity) [ Homo sapiens ]
• Official Symbol: IL3RA
• Synonyms: IL3RA; interleukin 3 receptor, alpha (low affinity); interleukin-3 receptor subunit alpha; CD123; IL-3RA; IL-3R-alpha; CD123 antigen; IL-3R subunit alpha; IL-3 receptor subunit alpha; IL-3 receptor alpha SP2 isoform; IL3R; IL3RX; IL3RY; IL3RAY; hIL-3Ra; MGC34174
• Gene ID: 3563
• mRNA Refseq: NM_002183
• Protein Refseq: NP_002174
• MIM: 308385
• UniProt ID: P26951