Recombinant Human IL36G Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: IL36G-5107H
• Product Overview: IL1F9 MS Standard C13 and N15-labeled recombinant protein (NP_062564) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.
• Molecular Mass: 18.7 kDa
• AA Sequence: MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNINDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: IL36G interleukin 36 gamma [ Homo sapiens (human) ]
• Official Symbol: IL36G
• Synonyms: IL36G; interleukin 36, gamma; IL1F9, interleukin 1 family, member 9; interleukin-36 gamma; IL 1F9; IL 1H1; IL 1RP2; IL1E; IL1H1; interleukin 1 related protein 2; interleukin 1 epsilon; interleukin 1 homolog 1; IL-1 epsilon; IL-1-epsilon; IL-1(EPSILON); interleukin-1 epsilon; IL-1 related protein 2; IL-1-related protein 2; interleukin-1 homolog 1; interleukin-1 family member 9; interleukin 1 family, member 9; interleukin 1-related protein 2; IL1F9; IL-1F9; IL-1H1; IL1RP2; IL-1RP2
• Gene ID: 56300
• mRNA Refseq: NM_019618
• Protein Refseq: NP_062564
• MIM: 605542
• UniProt ID: Q9NZH8