Recombinant Human IL36G Protein

• Cat.No.: IL36G-85H
• Product Overview: Recombinant Human Interleukin-36 gamma is produced by our E.coli expression system and the target gene encoding Ser18-Asp169 is expressed.

Specification

• Species: Human
• Source: E.coli
• Protein Length: Ser18-Asp169
• Description: Interleukin-36 gamma (IL-36γ) is a member of the interleukin 1 cytokine family that includes three closely related genes, IL-36α, β, and γ, formerly known as IL-1F6, F8, and F9 respectively. IL-36α has been detected in both neuronal and synovial tissue, whereas IL-36β and IL-36γ are expressed in both cutaneous and mucosal epithelial cells, including the respiratory tract. IL-36β and IL-36γ stimulate proliferation, maturation and/or cytokine expression by innate immune cells (such as keratinocytes and dendritic cells), and adaptive immune cells (neutrophils and T-cells) in both humans and mice. The activity of IL-36α is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). IL-36γ plays an important role in communicating the cell death to surrounding cells.
• Form: Lyophilized from a 0.2 um filtered solution of 20mM Tris,100mM Nacl, 0.1mM EDTA, pH8.0.
• AA Sequence: SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCL YCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELG KSYNTAFELNIND
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Quality Statement: Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: IL36G interleukin 36 gamma [ Homo sapiens (human) ]
• Official Symbol: IL36G
• Synonyms: Interleukin-36 gamma; IL36G; IL-1-related protein 2; IL-1 epsilon; Interleukin-1 homolog 1; IL1E; IL1F9; IL1H1; IL-1F9; IL-1H1; IL1RP2; IL-1RP2
• Gene ID: 56300
• mRNA Refseq: NM_019618.4
• Protein Refseq: NP_062564.1
• MIM: 605542
• UniProt ID: Q9NZH8