Recombinant Human IL29 Protein

Cat.No. : IL29-513H
Product Overview : Recombinant human IL29 protein
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Protein Length : 200
Description : This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA).
Form : Lyophilized
AA Sequence : MAAAWTVVLVTLVLGLAVAGPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name IL29 interleukin 29 (interferon, lambda 1) [ Homo sapiens (human) ]
Official Symbol IL29
Synonyms IL29; interleukin 29 (interferon, lambda 1); interleukin 29; interleukin-29; IFNL1; IL 29; IFN-lambda-1; cytokine Zcyto21; interferon lambda-1; interferon-lambda-1; interferon, lambda 1; IL-29;
Gene ID 282618
mRNA Refseq NM_172140
Protein Refseq NP_742152
MIM 607403
UniProt ID Q8IU54

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL29 Products

Required fields are marked with *

My Review for All IL29 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon