Active Recombinant Human IL29 Protein

Cat.No. : IL29-5200H
Product Overview : Human IL29 (Q8IU54 , 24 a.a. - 200 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 24-200 a.a.
Description : This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). [provided by RefSeq
Form : Lyophilized
Bio-activity : The ED50 is determined in an anti-viral assay using human HepG2 cells infected with EMCV is typically 1-5 ng/mL.
Molecular Mass : 20 kDa
AA Sequence : TSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
Endotoxin : < 0.1 ng/μg (1 EU/μg)
Purity : > 90% by SDS-PAGE and HPLC
Applications : Functional Study
SDS-PAGE
Storage : Store at -20 centigrade on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 centigrade for 1 month or store at -20 centigrade for 6 months. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : Lyophilized from 20 mM PB, 130 mM NaCl, pH 7.5
Gene Name IL29 interleukin 29 (interferon, lambda 1) [ Homo sapiens ]
Official Symbol IL29
Synonyms IL29; interleukin 29 (interferon, lambda 1); interleukin 29; interleukin-29; IFNL1; IL 29; IFN-lambda-1; cytokine Zcyto21; interferon lambda-1; interferon-lambda-1; interferon, lambda 1; IL-29;
Gene ID 282618
mRNA Refseq NM_172140
Protein Refseq NP_742152
MIM 607403
UniProt ID Q8IU54

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL29 Products

Required fields are marked with *

My Review for All IL29 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon