Description :	The protein encoded by this gene is a type I transmembrane protein identified as a subunit of the interleukin 12 receptor complex. The coexpression of this and IL12RB1 proteins was shown to lead to the formation of high-affinity IL12 binding sites and reconstitution of IL12 dependent signaling. The expression of this gene is up-regulated by interferon gamma in Th1 cells, and plays a role in Th1 cell differentiation. The up-regulation of this gene is found to be associated with a number of infectious diseases, such as Crohns disease and leprosy, which is thought to contribute to the inflammatory response and host defense.
Protein length :	110 amino acids
Molecular Weight :	37.730kDa
Source :	Wheat germ
Tissue specificity :	Isoform 2 is expressed at similar levels in both naive and activated T-cells.
Form :	Liquid
Purity :	Proprietary Purification
Storage buffer :	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage :	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids :	CINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACT WERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFG INLTPESPESNFTAKVTAVNSLGSSSSLPS
Sequence Similarities :	Belongs to the type I cytokine receptor family. Type 2 subfamily.Contains 5 fibronectin type-III domains.
Tag :	Non

Gene Name	IL12RB2 interleukin 12 receptor, beta 2 [ Homo sapiens ]
Official Symbol	IL12RB2
Synonyms	IL12RB2; interleukin 12 receptor, beta 2; interleukin-12 receptor subunit beta-2;
Gene ID	3595
mRNA Refseq	NM_001559
Protein Refseq	NP_001550
MIM	601642
Uniprot ID	Q99665
Chromosome Location	1p31.3-p31.2
Pathway	Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; IL12-mediated signaling events, organism-specific biosystem; IL27-mediated signaling events, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem;
Function	cytokine receptor activity; protein kinase binding; receptor activity;