Description :	The protein encoded by this gene belongs to the cytokine receptor family. It is an accessory chain essential for the active interleukin 10 receptor complex. Coexpression of this and IL10RA proteins has been shown to be required for IL10-induced signal transduction. This gene and three other interferon receptor genes, IFAR2, IFNAR1, and IFNGR2, form a class II cytokine receptor gene cluster located in a small region on chromosome 21.
Source :	HEK293
Species :	Human
Tag :	His&Fc&Avi
Form :	Sterile PBS, pH7.4
Molecular Mass :	50 kDa
AA Sequence :	MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Endotoxin :	<1EU/ug by LAL
Purity :	>85% by SDS-PAGE
Storage :	Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration :	0.323mg/ml by BCA

Gene Name	IL10RB interleukin 10 receptor subunit beta [ Homo sapiens (human) ]
Official Symbol	IL10RB
Synonyms	CRFB4; IBD25; CRF2-4; D21S58; D21S66; CDW210B; IL-10R2; IL-10RB
Gene ID	3588
mRNA Refseq	NM_000628.5
Protein Refseq	NP_000619.3
MIM	123889
UniProt ID	Q08334

RAP1A-2584H	Recombinant Full Length Human RAP1A Protein, His-tagged	+Inquiry
EGF-04H	Recombinant Human EGF Protein	+Inquiry
S100A4-409H	Recombinant Full Length Human S100 calcium binding protein A4 Protein, His tagged	+Inquiry
HK2-41H	Recombinant Full Length Human hexokinase 2 Protein, His tagged	+Inquiry
Capn2-2632R	Active Recombinant Full Length Rat Calpain 2 Protein, His-tagged	+Inquiry