Recombinant Human IKZF2 Protein, GST-tagged
Cat.No. : | IKZF2-32H |
Product Overview : | Human ZNFN1A2 partial ORF ( NP_057344, 298 a.a. - 397 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the Ikaros family of zinc-finger proteins. Three members of this protein family (Ikaros, Aiolos and Helios) are hematopoietic-specific transcription factors involved in the regulation of lymphocyte development. This protein forms homo- or hetero-dimers with other Ikaros family members, and is thought to function predominantly in early hematopoietic development. Multiple transcript variants encoding different isoforms have been found for this gene, but the biological validity of some variants has not been determined. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | HFDMNLTYEKEAELMQSHMMDQAINNAITYLGAEALHPLMQHPPSTIAEVAPVISSAYSQVYHPNRIERPISRETADSHENNMDGPISLIRPKSRPQERE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IKZF2 |
Official Symbol | IKZF2 IKAROS family zinc finger 2 [ Homo sapiens (human) ] |
Synonyms | IKZF2; IKAROS family zinc finger 2; ANF1A2; HELIOS; ZNF1A2; ZNFN1A2; zinc finger protein Helios; ikaros family zinc finger protein 2; zinc finger DNA binding protein Helios; zinc finger protein, subfamily 1A, 2 (Helios) |
Gene ID | 22807 |
mRNA Refseq | NM_016260 |
Protein Refseq | NP_057344 |
MIM | 606234 |
UniProt ID | Q9UKS7 |
◆ Recombinant Proteins | ||
Ikzf2-3089M | Recombinant Mouse Ikzf2 protein, His&Myc-tagged | +Inquiry |
IKZF2-8105M | Recombinant Mouse IKZF2 Protein | +Inquiry |
IKZF2-32H | Recombinant Human IKZF2 Protein, GST-tagged | +Inquiry |
IKZF2-4487M | Recombinant Mouse IKZF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IKZF2-6175C | Recombinant Chicken IKZF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IKZF2-5252HCL | Recombinant Human IKZF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IKZF2 Products
Required fields are marked with *
My Review for All IKZF2 Products
Required fields are marked with *
0
Inquiry Basket