Recombinant Human IGFL1 Protein (25-110 aa), His-Myc-tagged
Cat.No. : | IGFL1-2627H |
Product Overview : | Recombinant Human IGFL1 Protein (25-110 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 25-110 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 16.8 kDa |
AA Sequence : | APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | IGFL1 IGF-like family member 1 [ Homo sapiens ] |
Official Symbol | IGFL1 |
Synonyms | UNQ644; APRG644; |
Gene ID | 374918 |
mRNA Refseq | NM_198541.1 |
Protein Refseq | NP_940943.1 |
MIM | 610544 |
UniProt ID | Q6UW32 |
◆ Recombinant Proteins | ||
IGFL1-502H | Recombinant Human IGFL1 Protein, MYC/DDK-tagged | +Inquiry |
IGFL1-416HFL | Recombinant Full Length Human IGFL1 Protein, C-Flag-tagged | +Inquiry |
IGFL1-2627H | Recombinant Human IGFL1 Protein (25-110 aa), His-Myc-tagged | +Inquiry |
IGFL1-1160H | Recombinant Human IGFL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IGFL1-3439H | Recombinant Human IGFL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGFL1-5263HCL | Recombinant Human IGFL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IGFL1 Products
Required fields are marked with *
My Review for All IGFL1 Products
Required fields are marked with *
0
Inquiry Basket