Recombinant Human IGFL1 Protein (25-110 aa), His-Myc-tagged

• Cat.No.: IGFL1-2627H
• Product Overview: Recombinant Human IGFL1 Protein (25-110 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: E.coli
• Source: E.coli
• Tag: His&Myc
• Protein Length: 25-110 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 16.8 kDa
• AA Sequence: APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: IGFL1 IGF-like family member 1 [ Homo sapiens ]
• Official Symbol: IGFL1
• Synonyms: UNQ644; APRG644
• Gene ID: 374918
• mRNA Refseq: NM_198541.1
• Protein Refseq: NP_940943.1
• MIM: 610544
• UniProt ID: Q6UW32