Recombinant Full Length Human IGFL1 Protein, C-Flag-tagged

• Cat.No.: IGFL1-416HFL
• Product Overview: Recombinant Full Length Human IGFL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The protein encoded by this gene is a member of the insulin-like growth factor family of signaling molecules. The encoded protein is synthesized as a precursor protein and is proteolytically cleaved to form a secreted mature peptide. The mature peptide binds to a receptor, which in mouse was found on the cell surface of T cells. Increased expression of this gene may be linked to psoriasis.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 12.2 kDa
• AA Sequence: MAPRGCIVAVFAIFCISRLLCSHGAPVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCG
  NCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Secreted Protein, Transmembrane
• Full Length: Full L.

Gene Information

• Gene Name: IGFL1 IGF like family member 1 [ Homo sapiens (human) ]
• Official Symbol: IGFL1
• Synonyms: UNQ644; APRG644
• Gene ID: 374918
• mRNA Refseq: NM_198541.2
• Protein Refseq: NP_940943.1
• MIM: 610544
• UniProt ID: Q6UW32