Recombinant Human IGFBP3 protein, GST-tagged

• Cat.No.: IGFBP3-1409H
• Product Overview: Recombinant Human IGFBP3 protein(113-210 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: N-GST
• Protein length: 113-210 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: LCVNASAVSRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEY
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: IGFBP3 insulin-like growth factor binding protein 3 [ Homo sapiens ]
• Official Symbol: IGFBP3
• Synonyms: IGFBP3; insulin-like growth factor binding protein 3; insulin-like growth factor-binding protein 3; acid stable subunit of the 140 K IGF complex; binding protein 29; binding protein 53; BP 53; growth hormone dependent binding protein; IBP3; IGF binding protein 3; IBP-3; IGFBP-3; IGF-binding protein 3; growth hormone-dependent binding protein; BP-53
• Gene ID: 3486
• mRNA Refseq: NM_000598
• Protein Refseq: NP_000589
• MIM: 146732
• UniProt ID: P17936