Recombinant Human IGF2BP1 protein, GST-tagged

• Cat.No.: IGF2BP1-526H
• Product Overview: Recombinant Human IGF2BP1(1 a.a. - 577 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Description: This gene encodes a member of the insulin-like growth factor 2 mRNA-binding protein family. The protein encoded by this gene contains four K homology domains and two RNA recognition motifs. It functions by binding to the mRNAs of certain genes, including insulin-like growth factor 2, beta-actin and beta-transducin repeat-containing protein, and regulating their translation. Two transcript variants encoding different isoforms have been found for this gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 89.87 kDa
• AA Sequence: MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVP KKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALK VSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQT QSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLK KVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSLQSHLIPGLNLAAVGL FPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSK VRMVIITGPPEAQFKAQGRIYGKLKEENFFGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPR DQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 1-577 a.a.

Gene Information

• Gene Name: IGF2BP1 insulin-like growth factor 2 mRNA binding protein 1 [ Homo sapiens ]
• Official Symbol: IGF2BP1
• Synonyms: IGF2BP1; insulin-like growth factor 2 mRNA binding protein 1; insulin-like growth factor 2 mRNA-binding protein 1; IGF II mRNA binding protein 1; IMP 1; ZBP-1; VICKZ family member 1; zipcode-binding protein 1; IGF2 mRNA-binding protein 1; IGF-II mRNA-binding protein 1; coding region determinant-binding protein; IMP1; ZBP1; CRDBP; IMP-1; CRD-BP; VICKZ1
• Gene ID: 10642
• mRNA Refseq: NM_001160423
• Protein Refseq: NP_001153895
• MIM: 608288
• UniProt ID: Q9NZI8
• Chromosome Location: 17q21.32
• Pathway: Binding of RNA by Insulin-like Growth Factor-2 mRNA Binding Proteins (IGF2BPs/IMPs/VICKZs), organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem
• Function: mRNA 3-UTR binding; mRNA 5-UTR binding; mRNA binding; nucleotide binding; protein binding; translation regulator activity