Recombinant Human IFNK protein, His-PDI-tagged

• Cat.No.: IFNK-5343H
• Product Overview: Recombinant Human IFNK protein(Q9P0W0)(28-207aa), fused with C-terminal His and PDI tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: C-His-PDI
• ProteinLength: 28-207aa
• Tag: C-His-PDI
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 80.1 kDa
• AASequence: LDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: IFNK interferon, kappa [ Homo sapiens ]
• Official Symbol: IFNK
• Synonyms: IFNK; interferon, kappa; interferon kappa; IFN-kappa; interferon-like protein; RP11-27J8.1
• Gene ID: 56832
• mRNA Refseq: NM_020124
• Protein Refseq: NP_064509
• UniProt ID: Q9P0W0