Recombinant Human IFNK protein, His-PDI-tagged

Cat.No. : IFNK-5343H
Product Overview : Recombinant Human IFNK protein(Q9P0W0)(28-207aa), fused with C-terminal His and PDI tag, was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 28-207aa
Tag : C-His-PDI
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 80.1 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : LDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
Gene Name IFNK interferon, kappa [ Homo sapiens ]
Official Symbol IFNK
Synonyms IFNK; interferon, kappa; interferon kappa; IFN-kappa; interferon-like protein; RP11-27J8.1;
Gene ID 56832
mRNA Refseq NM_020124
Protein Refseq NP_064509
UniProt ID Q9P0W0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IFNK Products

Required fields are marked with *

My Review for All IFNK Products

Required fields are marked with *

0

Inquiry Basket

cartIcon