Recombinant Human IFNK protein, His-GST-tagged

• Cat.No.: IFNK-69H
• Product Overview: Recombinant Human IFNK Protein(NP_064509.2)(Leu28~Lys207) is expressed from E. coli with two N-terminal Tag, His and GST Tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His&GST
• ProteinLength: Leu28~Lys207
• Description: This gene encodes a member of the type I interferon family. Type I interferons are a group of related glycoproteins that play an important role in host defenses against viral infections. This protein is expressed in keratinocytes and the gene is found on chromosome 9, adjacent to the type I interferon cluster.
• Form: 20mM Tris, 150mM NaCl, pH8.0, containing 0.01% SKL, 5% Trehalose.
• Molecular Mass: 52kDa as determined by SDS-PAGE reducing conditions.
• AA Sequence: LDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
• Endotoxin: < 1.0EU per 1µg (determined by the LAL method)
• Purity: > 90%
• Applications: Positive Control; Immunogen; SDS-PAGE; WB.
  If bio-activity of the protein is needed, please check active protein.
• Notes: The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
• Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
• Storage: Avoid repeated freeze/thaw cycles.
  Store at 2-8°C for one month.
  Aliquot and store at -80°C for 12 months.
• Concentration: 200µg/mL
• Reconstitution: Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.

Gene Information

• Gene Name: IFNK interferon kappa [ Homo sapiens (human) ]
• Official Symbol: IFNK
• Synonyms: IFNT1; INFE1
• Gene ID: 56832
• mRNA Refseq: NM_020124.3
• Protein Refseq: NP_064509.2
• MIM: 615326
• UniProt ID: Q9P0W0