Recombinant Human IFNGR2 protein, His-tagged
Cat.No. : | IFNGR2-20H |
Product Overview : | Recombinant Human IFNGR2 protein(125-324 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 125-324 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | AWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDSVSIIS |
Purity : | 75%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | IFNGR2 interferon gamma receptor 2 (interferon gamma transducer 1) [ Homo sapiens ] |
Official Symbol | IFNGR2 |
Synonyms | AF-1; IFGR2; IFNGT1; IMD28 |
Gene ID | 3460 |
mRNA Refseq | NM_005534 |
Protein Refseq | NP_005525 |
MIM | 147569 |
UniProt ID | P38484 |
◆ Recombinant Proteins | ||
Ifngr2-602M | Active Recombinant Mouse Ifngr2 Protein, His-tagged | +Inquiry |
Ifngr2-4445M | Recombinant Mouse Ifngr2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ifngr2-6955M | Recombinant Mouse Ifngr2 protein, His-tagged | +Inquiry |
IFNGR2-14083H | Recombinant Human IFNGR2, GST-tagged | +Inquiry |
IFNGR2-1609HFL | Recombinant Full Length Human IFNGR2 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNGR2-1899MCL | Recombinant Mouse IFNGR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNGR2 Products
Required fields are marked with *
My Review for All IFNGR2 Products
Required fields are marked with *
0
Inquiry Basket