Recombinant Full Length Human IFNGR2 Protein, C-Flag-tagged
Cat.No. : | IFNGR2-1609HFL |
Product Overview : | Recombinant Full Length Human IFNGR2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene (IFNGR2) encodes the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 35 kDa |
AA Sequence : | MRPTLLWSLLLLLGVFAAAAAAPPDPLSQLPAPQHPKIRLYNAEQVLSWEPVALSNSTRPVVYQVQFKYT DSKWFTADIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELGALHSAWVTMPWFQHYRNVTV GPPENIEVTPGEGSLIIRFSSPFDIADTSTAFFCYYVHYWEKGGIQQVKGPFRSNSISLDNLKPSRVYCL QVQAQLLWNKSNIFRVGHLSNISCYETMADASTELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYW FHTPPSIPLQIEEYLKDPTQPILEALDKDSSPKDDVWDSVSIISFPEKEQEDVLQTLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity |
Full Length : | Full L. |
Gene Name | IFNGR2 interferon gamma receptor 2 [ Homo sapiens (human) ] |
Official Symbol | IFNGR2 |
Synonyms | AF-1; IFGR2; IMD28; IFNGT1 |
Gene ID | 3460 |
mRNA Refseq | NM_005534.4 |
Protein Refseq | NP_005525.2 |
MIM | 147569 |
UniProt ID | P38484 |
◆ Recombinant Proteins | ||
IFNGR2-241H | Recombinant Human IFNGR2 | +Inquiry |
Ifngr2-6955M | Recombinant Mouse Ifngr2 protein, His-tagged | +Inquiry |
IFNGR2-1609HFL | Recombinant Full Length Human IFNGR2 Protein, C-Flag-tagged | +Inquiry |
IFNGR2-14083H | Recombinant Human IFNGR2, GST-tagged | +Inquiry |
IFNGR2-29421TH | Recombinant Human IFNGR2, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNGR2-1899MCL | Recombinant Mouse IFNGR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNGR2 Products
Required fields are marked with *
My Review for All IFNGR2 Products
Required fields are marked with *
0
Inquiry Basket