Recombinant Human IFNGR1 protein

• Cat.No.: IFNGR1-116H
• Product Overview: Recombinant human IFNGR1 extracellular domain cDNA (18-245 aa fragment) fused with 29aa tag fusion protein at N-terminal was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFEMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEV KNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEE KQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQY CVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG
• Purity: >90% by SDS-PAGE
• Applications: 1. Used as a soluble / functional protein for interfeson pathway and iPS generation efficiency study.2. As excellent subunit receptor protein for heterodimer dynamic interaction study.3. As immunogen for specific antibody production.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
• Tag: Non
• Protein length: 18-245 a.a.

Gene Information

• Gene Name: IFNGR1 interferon gamma receptor 1 [ Homo sapiens ]
• Official Symbol: IFNGR1
• Synonyms: IFNGR1; interferon gamma receptor 1; IFNGR; CD119; CDw119; AVP, type 2; IFN-gamma-R1; CD119 antigen; IFN-gamma receptor 1
• Gene ID: 3459
• mRNA Refseq: NM_000416
• Protein Refseq: NP_000407
• MIM: 107470
• UniProt ID: P15260
• Chromosome Location: 6q23-q24
• Pathway: Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem
• Function: cytokine binding; interferon-gamma receptor activity; receptor activity