Active Recombinant Human Interferon Gamma Receptor 1, Fc Chimera

• Cat.No.: IFNGR1-22H
• Product Overview: Recombinant Human Interferon Gamma Receptor 1 encoding the signal peptide and extracellular domain of human IFN-gamma R1 (aa 1-245) chain was fused to the Fc region of human IgG1 (aa 93-330). The chimeric protein was expressed in modifiedhuman 293 cells.

Specification

• Cat. No.: IFNGR1-22H
• Description: Interferon-gamma (IFN-gamma) is a pleotropic cytokine expressed predominantly by naïve and activated CD8+ and TH1 CD4+ T cells, and natural killer (NK) cells and, as such, promotes both innate and adaptive immune responses.The activity of IFN-gamma is mediated through its receptor, the high-affinity IFN-gamma receptor complex, a class II cytokine receptor that is present on T cells, B cells, macrophages, neutrophils and NK cells as well as non-immune somatic cells such as endothelial cells and fibroblasts.
• Source: Human 293 cells.
• Amino Acid Sequence: EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKGGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
• Molecular Mass: IFN-gamma R1 – Fc Chimera migrates as a broad band between 60 and 85 kDa on SDS-PAGE due to post-translation modifications, in particular glycosylation.
• pI: IFN-gamma R1 – Fc Chimera separates into a number of glycoforms with a pI between 5 and 8 in 2D PAGE due to post-translational modifications, in particular glycosylation.
• % Carbohydrate: Purified IFN-gamma R1 – Fc Chimera consists of 10-35% carbohydrate by weight.
• Glycosylation: IFN-gamma R1 – Fc Chimera has N- and possibly O-linked oligosaccharides.
• Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
• Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
• Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
• Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
• Activity: The ED50 of IFN-gamma R1 – Fc Chimera is typically 0.05-0.1 μg/ml as measured by its ability to neutralize IFN gamma mediated cytotoxicity using the HT-29 colorectal adenocarcinoma cell line.
• Protein length: 1-245 a.a.

Gene Information

• Gene Name: IFNGR1 interferon gamma receptor 1 [ Homo sapiens ]
• Synonyms: IFNGR1; interferon gamma receptor 1; CD119; IFNGR; FLJ45734; AVP, type 2; CD119 antigen; immune interferon receptor 1; interferon-gamma receptor alpha chain; IFN-gamma-R1; OTTHUMP00000017285; interferon gamma receptor 1
• Gene ID: 3459
• mRNA Refseq: NM_000416
• Protein Refseq: NP_000407
• UniProt ID: P15260
• Chromosome Location: 6q23-q24
• MIM: 107470
• Pathway: Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway; Natural killer cell mediated cytotoxicity
• Function: cytokine binding; interferon-gamma receptor activity; receptor activity