Recombinant Human IFNB1 therapeutic protein(Interferon beta-1a)

• Cat.No.: IFNB1-P018H
• Product Overview: Human interferon beta (166 residues), glycosylated, MW=22.5kD. It is produced by mammalian cells (Chinese Hamster Ovary cells) into which the human interferon beta gene has been introduced. The amino acid sequence of Avonex is identical to that of natural human interferon beta.

Specification

• Description: It has been suggested that IFNB1 be merged into this article or section. The expression product is the active ingredient of Avonex, Belerofon and Rebif.
• Source: CHO
• Species: Human
• Molecular Mass: 20.5KDa
• Protein length: 166 Aa
• AA Sequence: MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFR QDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCA WTIVRVEILRNFYFINRLTGYLRN
• Endotoxin: < 1.0 EU per μg of the protein
• Purity: >95%
• Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
• Tag: Non
• Alias: IFNB1; IFNB; IFB; IFF; IFN-beta; Interferon beta-1a

Gene Information

• Gene Name: IFNB1 interferon, beta 1, fibroblast [ Homo sapiens ]
• Official Symbol: IFNB1
• Synonyms: IFNB1; interferon, beta 1, fibroblast; IFNB; interferon beta; IFB; IFF; IFN-beta; fibroblast interferon; MGC96956
• Gene ID: 3456
• mRNA Refseq: NM_002176
• Protein Refseq: NP_002167
• MIM: 147640
• UniProt ID: P01574
• Chromosome Location: 9p22
• Pathway: Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem
• Function: cytokine activity; interferon-alpha/beta receptor binding; transcription corepressor activity