Recombinant Human IFNA14 Protein (24-189 aa), His-tagged

• Cat.No.: IFNA14-1423H
• Product Overview: Recombinant Human IFNA14 Protein (24-189 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 24-189 aa
• Description: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 21.7 kDa
• AA Sequence: CNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFEFPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLEACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: IFNA14 interferon, alpha 14 [ Homo sapiens ]
• Official Symbol: IFNA14
• Synonyms: IFNA14; LEIF2H; leIF H; IFN-alpha-14; IFN-alphaH; MGC125756; MGC125757
• Gene ID: 3448
• mRNA Refseq: NM_002172
• Protein Refseq: NP_002163
• MIM: 147579
• UniProt ID: P01570