Recombinant Human IFNA1 protein, His-SUMO-tagged
Cat.No. : | IFNA1-4250H |
Product Overview : | Recombinant Human IFNA1 protein(P01562)(24-189aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-189aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.4 kDa |
AA Sequence : | CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IFNA1 interferon, alpha 1 [ Homo sapiens ] |
Official Symbol | IFNA1 |
Synonyms | IFNA1; interferon, alpha 1; interferon alpha-1/13; IFL; IFN; IFN ALPHA; IFN alpha 1b; IFN alphaD; IFNA13; IFNA@; interferon alpha 1b; leIF D; IFN-alpha 1b; IFN-alpha-1/13; interferon-alpha1; interferon alpha-D; IFN-ALPHA; IFN-alphaD; MGC138207; MGC138505; MGC138507; |
Gene ID | 3439 |
mRNA Refseq | NM_024013 |
Protein Refseq | NP_076918 |
MIM | 147660 |
UniProt ID | P01562 |
◆ Recombinant Proteins | ||
IFNA1-973H | Recombinant Horse IFNA1 Protein, His-tagged | +Inquiry |
IFNA1-01P | Recombinant Porcine IFNA1 Protein, His-tagged | +Inquiry |
IFNA1-637H | Recombinant Human IFNA1 protein, His & GST-tagged | +Inquiry |
IFNA1-256H | Recombinant Human IFNA1, StrepII-tagged | +Inquiry |
Ifna1-7448R | Active Recombinant Rat Ifna1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNA1-1513RCL | Recombinant Rat IFNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNA1 Products
Required fields are marked with *
My Review for All IFNA1 Products
Required fields are marked with *
0
Inquiry Basket