Recombinant Human IFNA1, StrepII-tagged

• Cat.No.: IFNA1-256H
• Product Overview: Purified, full-length human recombinant IFNA1/13 or Interferon alpha-1/13 protein (amino acids 24-189, 166 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 19.4 kDa. (Accession NP_008831.3; UniProt P01562)

Specification

• Species: Human
• Source: Human Cells
• Tag: Strep II
• Protein Length: 24-189, 166 a.a.
• Description: IFNA1/13 is produced by macrophages and has antiviral activities. It stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• AA Sequence: CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQ QLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: IFNA1 interferon, alpha 1 [ Homo sapiens ]
• Official Symbol: IFNA1
• Synonyms: IFNA1; interferon, alpha 1; interferon alpha-1/13; IFL; IFN; IFN ALPHA; IFN alpha 1b; IFN alphaD; IFNA13; IFNA@; interferon alpha 1b; leIF D; IFN-alpha 1b; IFN-alpha-1/13; interferon-alpha1; interferon alpha-D; IFN-ALPHA; IFN-alphaD; MGC138207; MGC138505; MGC138507
• Gene ID: 3439
• mRNA Refseq: NM_024013
• Protein Refseq: NP_076918
• MIM: 147660
• UniProt ID: P01562
• Chromosome Location: 9p22
• Pathway: Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytosolic DNA-sensing pathway, organism-specific biosystem; Cytosolic DNA-sensing pathway, conserved biosystem