Recombinant Human IFIH1
Cat.No. : | IFIH1-28633TH |
Product Overview : | Recombinant fragment corresponding to amino acids 928-1023 of Human MDA5 with a proprietary tag; Predicted MWt 36.19 including tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 928-1023 a.a. |
Description : | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon (IFNB) and a protein kinase C-activating compound, mezerein (MEZ). Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation. |
Molecular Weight : | 36.190kDa inclusive of tags |
Tissue specificity : | Widely expressed, at a low level. Expression is detected at slightly highest levels in placenta, pancreas and spleen and at barely levels in detectable brain, testis and lung. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | HVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSD |
Sequence Similarities : | Belongs to the helicase family.Contains 2 CARD domains.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain. |
Gene Name | IFIH1 interferon induced with helicase C domain 1 [ Homo sapiens ] |
Official Symbol | IFIH1 |
Synonyms | IFIH1; interferon induced with helicase C domain 1; interferon-induced helicase C domain-containing protein 1; helicard; Hlcd; IDDM19; MDA 5; MDA5; |
Gene ID | 64135 |
mRNA Refseq | NM_022168 |
Protein Refseq | NP_071451 |
MIM | 606951 |
Uniprot ID | Q9BYX4 |
Chromosome Location | 2q24.2 |
Pathway | Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; Immune System, organism-specific biosystem; Influenza A, organism-specific biosystem; Influenza A, conserved biosystem; |
Function | ATP binding; DNA binding; double-stranded RNA binding; helicase activity; hydrolase activity, acting on acid anhydrides; |
◆ Recombinant Proteins | ||
IFIH1-1252H | Recombinant Human IFIH1 Protein, His-tagged | +Inquiry |
IFIH1-2162H | Recombinant Human IFIH1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IFIH1-2022R | Recombinant Rhesus Macaque IFIH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFIH1-2201R | Recombinant Rhesus monkey IFIH1 Protein, His-tagged | +Inquiry |
IFIH1-04HFL | Active Recombinant Full Length Human IFIH1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFIH1-5289HCL | Recombinant Human IFIH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFIH1 Products
Required fields are marked with *
My Review for All IFIH1 Products
Required fields are marked with *
0
Inquiry Basket