Active Recombinant Full Length Human IFIH1 Protein, C-Flag-tagged
Cat.No. : | IFIH1-04HFL |
Product Overview : | Recombinant Full Length Human IFIH1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | IFIH1 encodes MDA5 which is an intracellular sensor of viral RNA that triggers the innate immune response. Sensing RNA length and secondary structure, MDA5 binds dsRNA oligonucleotides with a modified DExD/H-box helicase core and a C-terminal domain, thus leading to a proinflammatory response that includes interferons. It has been shown that Coronaviruses (CoVs) as well as various other virus families, are capable of evading the MDA5-dependent interferon response, thus impeding the activation of the innate immune response to infection. MDA5 has also been shown to play an important role in enhancing natural killer cell function in malaria infection. In addition to its protective role in antiviral responses, MDA5 has been implicated in autoimmune and autoinflammatory diseases such as type 1 diabetes, systemic lupus erythematosus, and Aicardi-Goutieres syndrome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | ELISA capture for autoantibodies |
Molecular Mass : | 116.5 kDa |
AA Sequence : | MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGV WHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCME EELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSESNAEIE NLSQVDGPQVEEQLLSTTVQPNLEKEVWGMENNSSESSFADSSVVSESDTSLAEGSVSCLDESLGHNSNM GSDSGTMGSDSDEENVAARASPEPELQLRPYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKK KKASEPGKVIVLVNKVLLVEQLFRKEFQPFLKKWYRVIGLSGDTQLKISFPEVVKSCDIIISTAQILENS LLNLENGEDAGVQLSDFSLIIIDECHHTNKEAVYNNIMRHYLMQKLKNNRLKKENKPVIPLPQILGLTAS PGVGGATKQAKAEEHILKLCANLDAFTIKTVKENLDQLKNQIQEPCKKFAIADATREDPFKEKLLEIMTR IQTYCQMSPMSDFGTQPYEQWAIQMEKKAAKEGNRKERVCAEHLRKYNEALQINDTIRMIDAYTHLETFY NEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEK LTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKPMTQNE QKEVISKFRTGKINLLIATTVAEEGLDIKECNIVIRYGLVTNEIAMVQARGRARADESTYVLVAHSGSGV IERETVNDFREKMMYKAIHCVQNMKPEEYAHKILELQMQSIMEKKMKTKRNIAKHYKNNLSLITFLCKNC SVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKTLQKKCADYQINGEIICKCGQAWGTMMVHKGLDLP CLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSECCLFSDEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | RIG-I-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | IFIH1 interferon induced with helicase C domain 1 [ Homo sapiens (human) ] |
Official Symbol | IFIH1 |
Synonyms | AGS7; Hlcd; IDDM19; MDA-5; MDA5; RLR-2; SGMRT1 |
Gene ID | 64135 |
mRNA Refseq | NM_022168.4 |
Protein Refseq | NP_071451.2 |
MIM | 606951 |
UniProt ID | Q9BYX4 |
◆ Recombinant Proteins | ||
IFIH1-4122C | Recombinant Chicken IFIH1 | +Inquiry |
IFIH1-01HFL | Recombinant Full Length Human IFIH1 Protein, His tagged | +Inquiry |
IFIH1-8013M | Recombinant Mouse IFIH1 Protein | +Inquiry |
IFIH1-5089H | Recombinant Human IFIH1 Protein (Ser2-Asp1025), N-His and C-V5 tagged | +Inquiry |
IFIH1-0073H | Recombinant Human IFIH1 Protein (Met1-Asp1025), N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFIH1-5289HCL | Recombinant Human IFIH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFIH1 Products
Required fields are marked with *
My Review for All IFIH1 Products
Required fields are marked with *
0
Inquiry Basket