Recombinant Human IFI6 Protein (24-130 aa), His-B2M-tagged

• Cat.No.: IFI6-2182H
• Product Overview: Recombinant Human IFI6 Protein (24-130 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: E.coli
• Tag: His&B2M
• ProteinLength: 24-130 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 24.4 kDa
• AA Sequence: GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEEDEE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: IFI6 interferon alpha inducible protein 6 [ Homo sapiens (human) ]
• Official Symbol: IFI6
• Synonyms: 6-16; G1P3; FAM14C; IFI616; IFI-6-16
• Gene ID: 2537
• mRNA Refseq: NM_002038
• Protein Refseq: NP_002029
• UniProt ID: P09912