Recombinant Human IFI6 Protein, GST-tagged

Cat.No. : IFI6-4608H
Product Overview : Human G1P3 full-length ORF ( AAH11601, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene was first identified as one of the many genes induced by interferon. The encoded protein may play a critical role in the regulation of apoptosis. A minisatellite that consists of 26 repeats of a 12 nucleotide repeating element resembling the mammalian splice donor consensus sequence begins near the end of the second exon. Alternatively spliced transcript variants that encode different isoforms by using the two downstream repeat units as splice donor sites have been described. [provided by RefSeq
Molecular Mass : 40.04 kDa
AA Sequence : MRQKAVSLFLCYLLLFTCSGVEAGKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPALGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLVATLQSLGAGGSCVVIGNIGALMGYATHKYLDSEEDEE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name IFI6 interferon, alpha-inducible protein 6 [ Homo sapiens ]
Official Symbol IFI6
Synonyms IFI6; interferon, alpha-inducible protein 6; G1P3, interferon, alpha inducible protein (clone IFI 6 16); interferon alpha-inducible protein 6; 6 16; FAM14C; IFI 6 16; IFI616; interferon-induced protein 6-16; interferon, alpha-inducible protein clone IFI-6-16; 6-16; G1P3; IFI-6-16;
Gene ID 2537
mRNA Refseq NM_002038
Protein Refseq NP_002029
MIM 147572
UniProt ID P09912

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IFI6 Products

Required fields are marked with *

My Review for All IFI6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon