Recombinant Human IFI35 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | IFI35-5254H |
Product Overview : | IFI35 MS Standard C13 and N15-labeled recombinant protein (NP_005524) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Myc&DDK |
Description : | Not yet known. |
Molecular Mass : | 31.7 kDa |
AA Sequence : | MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IFI35 interferon-induced protein 35 [ Homo sapiens (human) ] |
Official Symbol | IFI35 |
Synonyms | IFI35; interferon-induced protein 35; interferon-induced 35 kDa protein; IFP35; IFP 35; ifi-35; FLJ21753; |
Gene ID | 3430 |
mRNA Refseq | NM_005533 |
Protein Refseq | NP_005524 |
MIM | 600735 |
UniProt ID | P80217 |
◆ Recombinant Proteins | ||
Pnlip-1331M | Recombinant Mouse Pnlip Protein, His-SUMO-tagged | +Inquiry |
DKK1-430D | Active Recombinant Human DKK1 Protein | +Inquiry |
ZNF169-2575H | Recombinant Human ZNF169 protein, His-tagged | +Inquiry |
GDF7-107H | Recombinant Active Human GDF7 Protein, His-tagged(C-ter) | +Inquiry |
ZBBX-18695M | Recombinant Mouse ZBBX Protein | +Inquiry |
◆ Native Proteins | ||
GPT-1840H | Active Native Human GPT | +Inquiry |
MMP2-8455M | Native Mouse MMP2 | +Inquiry |
TF-002H | Native Human TF Protein, Rhodamine Conjugated | +Inquiry |
RSV-09 | Native Respiratory Syncytial Virus (RSV) Antigen | +Inquiry |
CSK-27872TH | Native Human CSK | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCBP3-1290HCL | Recombinant Human PCBP3 cell lysate | +Inquiry |
BOLL-8419HCL | Recombinant Human BOLL 293 Cell Lysate | +Inquiry |
VSX2-356HCL | Recombinant Human VSX2 cell lysate | +Inquiry |
DPM1-6835HCL | Recombinant Human DPM1 293 Cell Lysate | +Inquiry |
SNAI3-615HCL | Recombinant Human SNAI3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFI35 Products
Required fields are marked with *
My Review for All IFI35 Products
Required fields are marked with *
0
Inquiry Basket