Recombinant Human IFI35 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : IFI35-5254H
Product Overview : IFI35 MS Standard C13 and N15-labeled recombinant protein (NP_005524) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Not yet known.
Molecular Mass : 31.7 kDa
AA Sequence : MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGSALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPMVTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIFFGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQFTVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNIPDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGLAVFTSESGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name IFI35 interferon-induced protein 35 [ Homo sapiens (human) ]
Official Symbol IFI35
Synonyms IFI35; interferon-induced protein 35; interferon-induced 35 kDa protein; IFP35; IFP 35; ifi-35; FLJ21753;
Gene ID 3430
mRNA Refseq NM_005533
Protein Refseq NP_005524
MIM 600735
UniProt ID P80217

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IFI35 Products

Required fields are marked with *

My Review for All IFI35 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon