Recombinant Full Length Human IFI35 Protein
Cat.No. : | IFI35-249HF |
Product Overview : | Recombinant full length Human IFI35 with N-terminal proprietary tag. Predicted MW 57.75kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
ProteinLength : | 288 amino acids |
Description : | Enables identical protein binding activity. Involved in several processes, including macrophage activation involved in immune response; positive regulation of defense response; and regulation of signal transduction. Located in several cellular components, including cytosol; extracellular space; and nucleus. |
Form : | Liquid |
Molecular Mass : | 57.750kDa inclusive of tags |
AA Sequence : | MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDK VPFSVPKIPLVFRGHTQQDPEVPKSLVSNLRIHCPLLAGS ALITFDDPKVAEQVLQQKEHTINMEECRLRVQVQPLELPM VTTIQVMVSSQLSGRRVLVTGFPASLRLSEEELLDKLEIF FGKTRNGGGDVDVRELLPGSVMLGFARDGVAQRLCQIGQF TVPLGGQQVPLRVSPYVNGEIQKAEIRSQPVPRSVLVLNI PDILDGPELHDVLEIHFQKPTRGGGEVEALTVVPQGQQGL AVFTSESG |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | IFI35 interferon-induced protein 35 [ Homo sapiens ] |
Official Symbol | IFI35 |
Synonyms | IFI35; interferon-induced protein 35; interferon-induced 35 kDa protein; IFP35 |
Gene ID | 3430 |
mRNA Refseq | NM_005533 |
Protein Refseq | NP_005524 |
MIM | 600735 |
UniProt ID | P80217 |
◆ Recombinant Proteins | ||
GCK-6265M | Recombinant Mouse GCK Protein | +Inquiry |
HIST1H2BJ-2097R | Recombinant Rhesus monkey HIST1H2BJ Protein, His-tagged | +Inquiry |
CCL2-2950HF | Recombinant Full Length Human CCL2 Protein, GST-tagged | +Inquiry |
ITGA6-4995H | Recombinant Human ITGA6 Protein | +Inquiry |
Sdc1-8784RAF647 | Recombinant Rat Sdc1 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Native Proteins | ||
sPLA2-60B | Native Bee Venom sPLA2 Protein | +Inquiry |
Fxa-282B | Active Native Bovine Factor Xa - EGR | +Inquiry |
APOH-4217H | Native Human APOH protein | +Inquiry |
OX-LDL-985H | Native Human Lipoproteins, Oxidized LDL protein | +Inquiry |
LCN2-384H | Native Human LCN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM3D-806MCL | Recombinant Mouse FAM3D cell lysate | +Inquiry |
TLR1-1047HCL | Recombinant Human TLR1 293 Cell Lysate | +Inquiry |
MEIS2-4370HCL | Recombinant Human MEIS2 293 Cell Lysate | +Inquiry |
TEX29-8304HCL | Recombinant Human C13orf16 293 Cell Lysate | +Inquiry |
SIGLEC11-1848HCL | Recombinant Human SIGLEC11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFI35 Products
Required fields are marked with *
My Review for All IFI35 Products
Required fields are marked with *
0
Inquiry Basket