Recombinant Human IFI30 protein, His-tagged

• Cat.No.: IFI30-7855H
• Product Overview: Recombinant Human IFI30 protein(P13284)(1-232aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Source: HEK293
• Species: Human
• Tag: C-His
• Protein length: 1-232aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 27.4 kDa
• AASequence: MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEALCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDMELAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPLEDQTQLLTLVCQLYQGK
• Purity: Greater than 90% as determined by SDS-PAGE.
  Greater than 90% as determined by SEC-HPLC.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: IFI30 interferon, gamma-inducible protein 30 [ Homo sapiens ]
• Official Symbol: IFI30
• Synonyms: IFI30; interferon, gamma-inducible protein 30; GILT; IP30; IFI-30; gamma-interferon-inducible lysosomal thiol reductase; legumaturain; gamma-interferon-inducible protein IP-30; interferon gamma-inducible protein 30 preproprotein; MGC32056; EC 1.8; Legumaturain
• Gene ID: 10437
• mRNA Refseq: NM_006332
• Protein Refseq: NP_006323
• MIM: 604664
• UniProt ID: P13284