Recombinant Human IDH3G protein, His-SUMO-tagged

• Cat.No.: IDH3G-3064H
• Product Overview: Recombinant Human IDH3G protein(P51553)(40-393aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 40-393aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 54.8 kDa
• AA Sequence: FSEQTIPPSAKYGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDIRNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKSLPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRIAEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFENMIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYGHVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYATSIRKAVLASMDNENMHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: IDH3G isocitrate dehydrogenase 3 (NAD+) gamma [ Homo sapiens ]
• Official Symbol: IDH3G
• Synonyms: IDH3G; isocitrate dehydrogenase 3 (NAD+) gamma; isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial; IDH-gamma; NAD+-specific ICDH; NAD(+)-specific ICDH subunit gamma; isocitric dehydrogenase subunit gamma; NAD (H)-specific isocitrate dehydrogenase gamma subunit; isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, gamma subunit; H-IDHG
• Gene ID: 3421
• mRNA Refseq: NM_004135
• Protein Refseq: NP_004126
• MIM: 300089
• UniProt ID: P51553