Recombinant Human ID4

• Cat.No.: ID4-28078TH
• Product Overview: Recombinant full length Human ID4 with N terminal proprietary tag; Predicted MWt 43.78 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 161 amino acids
• Description: Transcription factors containing a basic helix-loop-helix (bHLH) motif regulate expression of tissue-specific genes in a number of mammalian and insect systems. DNA-binding activity of the bHLH proteins is dependent on formation of homo- and/or heterodimers. Dominant-negative HLH proteins encoded by Id-related genes, such as ID4, also contain the HLH-dimerization domain but lack the DNA-binding basic domain. Consequently, Id proteins inhibit binding to DNA and transcriptional transactivation by heterodimerization with bHLH proteins (Pagliuca et al.
• Molecular Weight: 43.780kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAA AAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVP TIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPP PAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILC R
• Sequence Similarities: Contains 1 basic helix-loop-helix (bHLH) domain.

Gene Information

• Gene Name: ID4 inhibitor of DNA binding 4, dominant negative helix-loop-helix protein [ Homo sapiens ]
• Official Symbol: ID4
• Synonyms: ID4; inhibitor of DNA binding 4, dominant negative helix-loop-helix protein; DNA-binding protein inhibitor ID-4; bHLHb27
• Gene ID: 3400
• mRNA Refseq: NM_001546
• Protein Refseq: NP_001537
• MIM: 600581
• Uniprot ID: P47928
• Chromosome Location: 6p22.3
• Pathway: Id Signaling Pathway, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem
• Function: RNA polymerase II transcription factor binding; protein binding; transcription corepressor activity